| Brand: | Abnova |
| Reference: | H00055832-M01 |
| Product name: | CAND1 monoclonal antibody (M01), clone 5D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CAND1. |
| Clone: | 5D7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 55832 |
| Gene name: | CAND1 |
| Gene alias: | DKFZp434M1414|FLJ10114|FLJ10929|FLJ38691|FLJ90441|KIAA0829|TIP120|TIP120A |
| Gene description: | cullin-associated and neddylation-dissociated 1 |
| Genbank accession: | NM_018448 |
| Immunogen: | CAND1 (NP_060918, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE |
| Protein accession: | NP_060918 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CAND1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | CAND1 Promotes PLK4-Mediated Centriole Overduplication and Is Frequently Disrupted in Prostate Cancer.Korzeniewski N, Hohenfellner M, Duensing S. Neoplasia. 2012 Sep;14(9):799-806. |