| Reference: | H00055829-B01 |
| Product name: | SELS MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SELS protein. |
| Gene id: | 55829 |
| Gene name: | SELS |
| Gene alias: | AD-015|ADO15|MGC104346|MGC2553|SBBI8|SEPS1|VIMP |
| Gene description: | selenoprotein S |
| Genbank accession: | BC005840 |
| Immunogen: | SELS (AAH05840, 1 a.a. ~ 189 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEVWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGG*G |
| Protein accession: | AAH05840 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Shipping condition: | Dry Ice |