Cart 46 Product Products 17 162,80 € (empty)
-
-
-
-
-
-
-
1 x SMNDC1-sur...113,40 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x ST3GAL4-ST...121,50 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
17 162,80 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 46 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 17 162,80 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 17 162,80 €
Data sheet of PECR monoclonal antibody (M02A), clone 2F10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PECR monoclonal antibody (M02A), clone 2F10
| Brand: | Abnova |
| Reference: | H00055825-M02A |
| Product name: | PECR monoclonal antibody (M02A), clone 2F10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PECR. |
| Clone: | 2F10 |
| Isotype: | IgM Kappa |
| Gene id: | 55825 |
| Gene name: | PECR |
| Gene alias: | HSA250303|SDR29C1|TERP |
| Gene description: | peroxisomal trans-2-enoyl-CoA reductase |
| Genbank accession: | BC002529 |
| Immunogen: | PECR (AAH02529, 1 a.a. ~ 303 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKL |
| Protein accession: | AAH02529 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (59.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |