Brand: | Abnova |
Reference: | H00055810-M09A |
Product name: | FOXJ2 monoclonal antibody (M09A), clone 1G12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXJ2. |
Clone: | 1G12 |
Isotype: | IgM Kappa |
Gene id: | 55810 |
Gene name: | FOXJ2 |
Gene alias: | FHX |
Gene description: | forkhead box J2 |
Genbank accession: | NM_018416 |
Immunogen: | FOXJ2 (NP_060886.1, 475 a.a. ~ 574 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TQTGHVPPQGGTHRPPAPARIADSCALTSGKQESAMSQVNSYGHPQAPHLYPGPSPMYPIPTQDSAGYNRPAHHMVPRPSVPPPGANEEIPDDFDWDLIT |
Protein accession: | NP_060886.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |