FOXJ2 monoclonal antibody (M06), clone 1C3 View larger

FOXJ2 monoclonal antibody (M06), clone 1C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXJ2 monoclonal antibody (M06), clone 1C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about FOXJ2 monoclonal antibody (M06), clone 1C3

Brand: Abnova
Reference: H00055810-M06
Product name: FOXJ2 monoclonal antibody (M06), clone 1C3
Product description: Mouse monoclonal antibody raised against a partial recombinant FOXJ2.
Clone: 1C3
Isotype: IgG2b Kappa
Gene id: 55810
Gene name: FOXJ2
Gene alias: FHX
Gene description: forkhead box J2
Genbank accession: NM_018416
Immunogen: FOXJ2 (NP_060886.1, 475 a.a. ~ 574 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TQTGHVPPQGGTHRPPAPARIADSCALTSGKQESAMSQVNSYGHPQAPHLYPGPSPMYPIPTQDSAGYNRPAHHMVPRPSVPPPGANEEIPDDFDWDLIT
Protein accession: NP_060886.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055810-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055810-M06-13-15-1.jpg
Application image note: Western Blot analysis of FOXJ2 expression in transfected 293T cell line by FOXJ2 monoclonal antibody (M06), clone 1C3.

Lane 1: FOXJ2 transfected lysate(62.4 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FOXJ2 monoclonal antibody (M06), clone 1C3 now

Add to cart