| Brand:  | Abnova | 
| Reference:  | H00055802-M02 | 
| Product name:  | DCP1A monoclonal antibody (M02), clone 2F11 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant DCP1A. | 
| Clone:  | 2F11 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 55802 | 
| Gene name:  | DCP1A | 
| Gene alias:  | FLJ21691|HSA275986|Nbla00360|SMAD4IP1|SMIF | 
| Gene description:  | DCP1 decapping enzyme homolog A (S. cerevisiae) | 
| Genbank accession:  | NM_018403 | 
| Immunogen:  | DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ | 
| Protein accession:  | NP_060873 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.74 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | DCP1A monoclonal antibody (M02), clone 2F11. Western Blot analysis of DCP1A expression in IMR-32 ( Cat # L008V1 ). | 
| Applications:  | WB-Ce,IF,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |