DCP1A monoclonal antibody (M02), clone 2F11 View larger

DCP1A monoclonal antibody (M02), clone 2F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DCP1A monoclonal antibody (M02), clone 2F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about DCP1A monoclonal antibody (M02), clone 2F11

Brand: Abnova
Reference: H00055802-M02
Product name: DCP1A monoclonal antibody (M02), clone 2F11
Product description: Mouse monoclonal antibody raised against a partial recombinant DCP1A.
Clone: 2F11
Isotype: IgG1 Kappa
Gene id: 55802
Gene name: DCP1A
Gene alias: FLJ21691|HSA275986|Nbla00360|SMAD4IP1|SMIF
Gene description: DCP1 decapping enzyme homolog A (S. cerevisiae)
Genbank accession: NM_018403
Immunogen: DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
Protein accession: NP_060873
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055802-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055802-M02-1-19-1.jpg
Application image note: DCP1A monoclonal antibody (M02), clone 2F11. Western Blot analysis of DCP1A expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DCP1A monoclonal antibody (M02), clone 2F11 now

Add to cart