| Brand: | Abnova |
| Reference: | H00055802-M01 |
| Product name: | DCP1A monoclonal antibody (M01), clone 2D12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DCP1A. |
| Clone: | 2D12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 55802 |
| Gene name: | DCP1A |
| Gene alias: | FLJ21691|HSA275986|Nbla00360|SMAD4IP1|SMIF |
| Gene description: | DCP1 decapping enzyme homolog A (S. cerevisiae) |
| Genbank accession: | NM_018403 |
| Immunogen: | DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ |
| Protein accession: | NP_060873 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DCP1A monoclonal antibody (M01), clone 2D12. Western Blot analysis of DCP1A expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |