Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MBD5 monoclonal antibody (M01), clone 4A12-1B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about MBD5 monoclonal antibody (M01), clone 4A12-1B6
| Brand: | Abnova |
| Reference: | H00055777-M01 |
| Product name: | MBD5 monoclonal antibody (M01), clone 4A12-1B6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant MBD5. |
| Clone: | 4A12-1B6 |
| Isotype: | IgG1 kappa |
| Gene id: | 55777 |
| Gene name: | MBD5 |
| Gene alias: | FLJ11113|FLJ30517|KIAA1461|MRD1 |
| Gene description: | methyl-CpG binding domain protein 5 |
| Genbank accession: | BC014534 |
| Immunogen: | MBD5 (AAH14534.1, 1 a.a. ~ 229 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRKQPPTTVLSLLRQSQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNSTPGCGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSNSPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTPVIPNSIVSSYNQTSSEAGMVLLEKSTQRY |
| Protein accession: | AAH14534.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (50.93 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MBD5 expression in transfected 293T cell line by MBD5 monoclonal antibody (M01), clone 4A12-1B6. Lane 1: MBD5 transfected lysate(24.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |