Cart 1 Product Products 384,00 € (empty)
No products
To be determined Shipping
384,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 384,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 384,00 €
Data sheet of ZNF83 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about ZNF83 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00055769-A01 |
| Product name: | ZNF83 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ZNF83. |
| Gene id: | 55769 |
| Gene name: | ZNF83 |
| Gene alias: | FLJ11015|FLJ14876|FLJ30097|FLJ90585|HPF1|MGC33853|ZNF816B |
| Gene description: | zinc finger protein 83 |
| Genbank accession: | NM_018300 |
| Immunogen: | ZNF83 (NP_060770, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSSSLVSPPQRISSTVKTHISHTYECNFVDSLFTQKEKANIGTEHYKCNERGKAFHQGLHFTIH |
| Protein accession: | NP_060770 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.32 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | ZNF83 polyclonal antibody (A01), Lot # 051115JC01. Western Blot analysis of ZNF83 expression in Raw 264.7. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |