| Brand: | Abnova |
| Reference: | H00055748-A01 |
| Product name: | CNDP2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CNDP2. |
| Gene id: | 55748 |
| Gene name: | CNDP2 |
| Gene alias: | CN2|CPGL|FLJ10830|HsT2298|PEPA |
| Gene description: | CNDP dipeptidase 2 (metallopeptidase M20 family) |
| Genbank accession: | NM_018235 |
| Immunogen: | CNDP2 (NP_060705, 191 a.a. ~ 300 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VCISDNYWLGKKKPCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQILLHSH |
| Protein accession: | NP_060705 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CNDP2 polyclonal antibody (A01), Lot # 060613JCS1 Western Blot analysis of CNDP2 expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |