No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00055746-M02 |
Product name: | NUP133 monoclonal antibody (M02), clone 4F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NUP133. |
Clone: | 4F6 |
Isotype: | IgG |
Gene id: | 55746 |
Gene name: | NUP133 |
Gene alias: | FLJ10814|MGC21133|hNUP133 |
Gene description: | nucleoporin 133kDa |
Genbank accession: | NM_018230 |
Immunogen: | NUP133 (NP_060700, 1069 a.a. ~ 1155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ |
Protein accession: | NP_060700 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.31 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | NUP133 monoclonal antibody (M02), clone 4F6. Western Blot analysis of NUP133 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |