Cart 54 Product Products 20 047,20 € (empty)
No products
To be determined Shipping
20 047,20 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 54 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 20 047,20 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 20 047,20 €
Data sheet of NUP133 monoclonal antibody (M01), clone 3E8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about NUP133 monoclonal antibody (M01), clone 3E8
| Brand: | Abnova |
| Reference: | H00055746-M01 |
| Product name: | NUP133 monoclonal antibody (M01), clone 3E8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NUP133. |
| Clone: | 3E8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 55746 |
| Gene name: | NUP133 |
| Gene alias: | FLJ10814|MGC21133|hNUP133 |
| Gene description: | nucleoporin 133kDa |
| Genbank accession: | NM_018230 |
| Immunogen: | NUP133 (NP_060700, 1069 a.a. ~ 1155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ |
| Protein accession: | NP_060700 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.31 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged NUP133 is 0.03 ng/ml as a capture antibody. |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Alterations in Nuclear Pore Architecture Allow Cancer Cell Entry into or Exit from Drug-Resistant Dormancy.Kinoshita Y, Kalir T, Rahaman J, Dottino P, Stave Kohtz D. Am J Pathol. 2011 Nov 7. |