No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00055697-M03 |
Product name: | VAC14 monoclonal antibody (M03), clone 3B2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant VAC14. |
Clone: | 3B2 |
Isotype: | IgG2a Kappa |
Gene id: | 55697 |
Gene name: | VAC14 |
Gene alias: | ArPIKfyve|FLJ10305|FLJ36622|FLJ46582|MGC149815|MGC149816|TAX1BP2|TRX |
Gene description: | Vac14 homolog (S. cerevisiae) |
Genbank accession: | NM_018052 |
Immunogen: | VAC14 (NP_060522.3, 714 a.a. ~ 782 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRVVL |
Protein accession: | NP_060522.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged VAC14 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |