| Brand:  | Abnova | 
| Reference:  | H00055692-M05 | 
| Product name:  | LUC7L monoclonal antibody (M05), clone 2D10 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant LUC7L. | 
| Clone:  | 2D10 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 55692 | 
| Gene name:  | LUC7L | 
| Gene alias:  | FLJ10231|LUC7-LIKE|LUC7B1|SR+89 | 
| Gene description:  | LUC7-like (S. cerevisiae) | 
| Genbank accession:  | NM_018032 | 
| Immunogen:  | LUC7L (NP_060502, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAE | 
| Protein accession:  | NP_060502 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (38.21 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunofluorescence of monoclonal antibody to LUC7L on HeLa cell. [antibody concentration 10 ug/ml] | 
| Applications:  | WB-Ce,IF,ELISA,WB-Re,WB-Tr,IP | 
| Shipping condition:  | Dry Ice |