Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LUC7L monoclonal antibody (M05), clone 2D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,ELISA,WB-Re,WB-Tr,IP |
More info about LUC7L monoclonal antibody (M05), clone 2D10
| Brand: | Abnova |
| Reference: | H00055692-M05 |
| Product name: | LUC7L monoclonal antibody (M05), clone 2D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LUC7L. |
| Clone: | 2D10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 55692 |
| Gene name: | LUC7L |
| Gene alias: | FLJ10231|LUC7-LIKE|LUC7B1|SR+89 |
| Gene description: | LUC7-like (S. cerevisiae) |
| Genbank accession: | NM_018032 |
| Immunogen: | LUC7L (NP_060502, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAE |
| Protein accession: | NP_060502 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to LUC7L on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |