Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC30A6 monoclonal antibody (M01), clone 2G6-G3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about SLC30A6 monoclonal antibody (M01), clone 2G6-G3
| Brand: | Abnova |
| Reference: | H00055676-M01 |
| Product name: | SLC30A6 monoclonal antibody (M01), clone 2G6-G3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SLC30A6. |
| Clone: | 2G6-G3 |
| Isotype: | IgG2a kappa |
| Gene id: | 55676 |
| Gene name: | SLC30A6 |
| Gene alias: | FLJ31101|MGC45055|MST103|MSTP103|ZNT6 |
| Gene description: | solute carrier family 30 (zinc transporter), member 6 |
| Genbank accession: | BC032525 |
| Immunogen: | SLC30A6 (AAH32525, 1 a.a. ~ 216 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP |
| Protein accession: | AAH32525 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Altered expression of two zinc transporters, SLC30A5 and SLC30A6, underlies a mammary gland disorder of reduced zinc secretion into milk.Kumar L, Michalczyk A, McKay J, Ford D, Kambe T, Hudek L, Varigios G, Taylor PE, Ackland ML. Genes Nutr. 2015 Sep;10(5):487 |