No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00055669-A01 |
Product name: | MFN1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MFN1. |
Gene id: | 55669 |
Gene name: | MFN1 |
Gene alias: | DKFZp762F247|FLJ20693|MGC41806|hfzo1|hfzo2 |
Gene description: | mitofusin 1 |
Genbank accession: | NM_017927 |
Immunogen: | MFN1 (NP_060397, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQGYKDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKV |
Protein accession: | NP_060397 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | MFN1 polyclonal antibody (A01), Lot # NBI0061117QCS1 Western Blot analysis of MFN1 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |