| Brand:  | Abnova | 
| Reference:  | H00055662-M01 | 
| Product name:  | HIF1AN monoclonal antibody (M01), clone 1D8 | 
| Product description:  | Mouse monoclonal antibody raised against a full-length recombinant HIF1AN. | 
| Clone:  | 1D8 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 55662 | 
| Gene name:  | HIF1AN | 
| Gene alias:  | DKFZp762F1811|FIH1|FLJ20615|FLJ22027 | 
| Gene description:  | hypoxia inducible factor 1, alpha subunit inhibitor | 
| Genbank accession:  | BC007719 | 
| Immunogen:  | HIF1AN (AAH07719.1, 1 a.a. ~ 349 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN | 
| Protein accession:  | AAH07719.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (64.13 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunofluorescence of monoclonal antibody to HIF1AN on HeLa cell. [antibody concentration 10 ug/ml] | 
| Applications:  | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP | 
| Shipping condition:  | Dry Ice |