No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00055643-A01 |
Product name: | BTBD2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant BTBD2. |
Gene id: | 55643 |
Gene name: | BTBD2 |
Gene alias: | - |
Gene description: | BTB (POZ) domain containing 2 |
Genbank accession: | NM_017797 |
Immunogen: | BTBD2 (NP_060267, 422 a.a. ~ 503 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | IQIIHTDSNTVLGQNDTGFSCDGSASTFRVMFKEPVEVLPNVNYTACATLKGPDSHYGTKGLRKVTHESPTTGAKTCFTFCY |
Protein accession: | NP_060267 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.13 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | BTBD2 polyclonal antibody (A01), Lot # 060613JCS1 Western Blot analysis of BTBD2 expression in NIH/3T3 ( Cat # L018V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |