No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,IHC-P,IF,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00055610-M01 |
Product name: | FLJ20097 monoclonal antibody (M01), clone 2D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FLJ20097. |
Clone: | 2D11 |
Isotype: | IgG2b Kappa |
Gene id: | 55610 |
Gene name: | CCDC132 |
Gene alias: | FLJ20097|FLJ23581|KIAA1861|MGC176659 |
Gene description: | coiled-coil domain containing 132 |
Genbank accession: | NM_017667 |
Immunogen: | FLJ20097 (NP_060137, 862 a.a. ~ 964 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDKEFVETYIKAYYLTENDMERWIKEHREYSTKQLTNLVNVCLGSHINKKARQKLLAAIDDIDRPKR |
Protein accession: | NP_060137 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | FLJ20097 monoclonal antibody (M01), clone 2D11 Western Blot analysis of FLJ20097 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,WB-Ti,IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | EARP is a multisubunit tethering complex involved in endocytic recycling.Schindler C, Chen Y, Pu J, Guo X, Bonifacino JS Nat Cell Biol. 2015 Mar 23. doi: 10.1038/ncb3129. |