Cart 52 Product Products 19 518,40 € (empty)
No products
To be determined Shipping
19 518,40 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 52 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 19 518,40 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 19 518,40 €
Data sheet of PPP1R9A monoclonal antibody (M01), clone 6A10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PPP1R9A monoclonal antibody (M01), clone 6A10
| Brand: | Abnova |
| Reference: | H00055607-M01 |
| Product name: | PPP1R9A monoclonal antibody (M01), clone 6A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PPP1R9A. |
| Clone: | 6A10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 55607 |
| Gene name: | PPP1R9A |
| Gene alias: | FLJ20068|KIAA1222|NRB1|NRBI|Neurabin-I |
| Gene description: | protein phosphatase 1, regulatory (inhibitor) subunit 9A |
| Genbank accession: | XM_371933 |
| Immunogen: | PPP1R9A (XP_371933, 1090 a.a. ~ 1188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PCSTAQTSTRSPCMPFSWFNDSRKGSYSFRNLPAPTSSLQPSPETLISDKKGSKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMI |
| Protein accession: | XP_371933 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |