Brand: | Abnova |
Reference: | H00055577-M05 |
Product name: | NAGK monoclonal antibody (M05), clone 1H8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant NAGK. |
Clone: | 1H8 |
Isotype: | IgG2b Kappa |
Gene id: | 55577 |
Gene name: | NAGK |
Gene alias: | GNK|HSA242910 |
Gene description: | N-acetylglucosamine kinase |
Genbank accession: | BC001029 |
Immunogen: | NAGK (AAH01029, 1 a.a. ~ 344 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS |
Protein accession: | AAH01029 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | NAGK monoclonal antibody (M05), clone 1H8. Western Blot analysis of NAGK expression in HepG2(Cat # L019V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |