| Brand: | Abnova |
| Reference: | H00055577-A01 |
| Product name: | NAGK polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant NAGK. |
| Gene id: | 55577 |
| Gene name: | NAGK |
| Gene alias: | GNK|HSA242910 |
| Gene description: | N-acetylglucosamine kinase |
| Genbank accession: | NM_017567 |
| Immunogen: | NAGK (NP_060037, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLR |
| Protein accession: | NP_060037 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NAGK polyclonal antibody (A01), Lot # 060102JC01. Western Blot analysis of NAGK expression in human ovarian cancer. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |