No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00055568-A01 |
Product name: | GALNT10 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GALNT10. |
Gene id: | 55568 |
Gene name: | GALNT10 |
Gene alias: | DKFZp586H0623|FLJ00205|FLJ11715|GalNAcT10|pp-GalNAc-T10 |
Gene description: | UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10) |
Genbank accession: | NM_198321 |
Immunogen: | GALNT10 (NP_938080, 503 a.a. ~ 602 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | FTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNR |
Protein accession: | NP_938080 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |