No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00055553-A01 |
Product name: | SOX6 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SOX6. |
Gene id: | 55553 |
Gene name: | SOX6 |
Gene alias: | HSSOX6 |
Gene description: | SRY (sex determining region Y)-box 6 |
Genbank accession: | NM_033326 |
Immunogen: | SOX6 (NP_201583, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDR |
Protein accession: | NP_201583 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | SOX6 polyclonal antibody (A01), Lot # 051207JCO1 Western Blot analysis of SOX6 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |