Brand: | Abnova |
Reference: | H00055521-M02 |
Product name: | TRIM36 monoclonal antibody (M02), clone 1G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM36. |
Clone: | 1G11 |
Isotype: | IgG1 Kappa |
Gene id: | 55521 |
Gene name: | TRIM36 |
Gene alias: | HAPRIN|RBCC728|RNF98 |
Gene description: | tripartite motif-containing 36 |
Genbank accession: | NM_018700 |
Immunogen: | TRIM36 (NP_061170, 391 a.a. ~ 499 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TSFEDYVVNTSKQTELLGELSFFSSGIDVPEINEEQSKVYNNALINWHHPEKDKADSYVLEYRKINRDDEMSWNEIEVCGTSKIIQDLENSSTYAFRVRAYKGSICSPC |
Protein accession: | NP_061170 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to TRIM36 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |