| Brand: | Abnova |
| Reference: | H00055520-M01 |
| Product name: | ELAC1 monoclonal antibody (M01), clone 1G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ELAC1. |
| Clone: | 1G2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 55520 |
| Gene name: | ELAC1 |
| Gene alias: | D29 |
| Gene description: | elaC homolog 1 (E. coli) |
| Genbank accession: | NM_018696 |
| Immunogen: | ELAC1 (NP_061166, 282 a.a. ~ 362 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QMDKAKEHGHSTPQMAATFAKLCRAKRLVLTHFSQRYKPVALAREGETDGIAELKKQAESVLDLQEVTLAEDFMVISIPIK |
| Protein accession: | NP_061166 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.65 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | ELAC1 monoclonal antibody (M01), clone 1G2 Western Blot analysis of ELAC1 expression in PC-12 ( Cat # L012V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |