Cart 1 Product Products 353,90 € (empty)
No products
To be determined Shipping
353,90 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 353,90 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 353,90 €
Data sheet of DDX43 monoclonal antibody (M07), clone 3G12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about DDX43 monoclonal antibody (M07), clone 3G12
| Brand: | Abnova |
| Reference: | H00055510-M07 |
| Product name: | DDX43 monoclonal antibody (M07), clone 3G12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DDX43. |
| Clone: | 3G12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 55510 |
| Gene name: | DDX43 |
| Gene alias: | DKFZp434H2114|HAGE |
| Gene description: | DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 |
| Genbank accession: | NM_018665 |
| Immunogen: | DDX43 (NP_061135.1, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SHHGGAPKASTWVVASRRSSTVSRAPERRPAEELNRTGPEGYSVGRGGRWRGTSRPPEAVAAGHEELPLCFALKSHFVGAVIGRGGSKI |
| Protein accession: | NP_061135.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of DDX43 expression in transfected 293T cell line by DDX43 monoclonal antibody (M07), clone 3G12. Lane 1: DDX43 transfected lysate(72.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Arresting of miR-186 and releasing of H19 by DDX43 facilitate tumorigenesis and CML progression.Lin J, Ma JC, Yang J, Yin JY, Chen XX, Guo H, Wen XM, Zhang TJ, Qian W, Qian J, Deng ZQ. Oncogene. 2018 Feb 16. [Epub ahead of print] |