Cart 8 Product Products 2 575,20 € (empty)
No products
To be determined Shipping
2 575,20 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 8 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 575,20 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 575,20 €
Data sheet of BATF3 monoclonal antibody (M04), clone 3H1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about BATF3 monoclonal antibody (M04), clone 3H1
| Brand: | Abnova |
| Reference: | H00055509-M04 |
| Product name: | BATF3 monoclonal antibody (M04), clone 3H1 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant BATF3. |
| Clone: | 3H1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 55509 |
| Gene name: | BATF3 |
| Gene alias: | JDP1|JUNDM1|SNFT |
| Gene description: | basic leucine zipper transcription factor, ATF-like 3 |
| Genbank accession: | NM_018664.1 |
| Immunogen: | BATF3 (NP_061134.1, 1 a.a. ~ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR |
| Protein accession: | NP_061134.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of BATF3 expression in transfected 293T cell line by BATF3 monoclonal antibody (M04), clone 3H1. Lane 1: BATF3 transfected lysate (Predicted MW: 14.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |