Brand: | Abnova |
Reference: | H00055504-M01A |
Product name: | TNFRSF19 monoclonal antibody (M01A), clone 2G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF19. |
Clone: | 2G4 |
Isotype: | IgG1 Kappa |
Gene id: | 55504 |
Gene name: | TNFRSF19 |
Gene alias: | TAJ|TAJ-alpha|TRADE|TROY |
Gene description: | tumor necrosis factor receptor superfamily, member 19 |
Genbank accession: | BC047321.1 |
Immunogen: | TNFRSF19 (AAH47321.1, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLP |
Protein accession: | AAH47321.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TNFRSF19 monoclonal antibody (M01A), clone 2G4 Western Blot analysis of TNFRSF19 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |