Cart 66 Product Products 23 039,30 € (empty)
No products
To be determined Shipping
23 039,30 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 66 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 23 039,30 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 23 039,30 €
Data sheet of TNFRSF19 monoclonal antibody (M01), clone 2G4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about TNFRSF19 monoclonal antibody (M01), clone 2G4
| Brand: | Abnova |
| Reference: | H00055504-M01 |
| Product name: | TNFRSF19 monoclonal antibody (M01), clone 2G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF19. |
| Clone: | 2G4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 55504 |
| Gene name: | TNFRSF19 |
| Gene alias: | TAJ|TAJ-alpha|TRADE|TROY |
| Gene description: | tumor necrosis factor receptor superfamily, member 19 |
| Genbank accession: | NM_018647 |
| Immunogen: | TNFRSF19 (NP_061117, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLP |
| Protein accession: | NP_061117 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TNFRSF19 monoclonal antibody (M01), clone 2G4 Western Blot analysis of TNFRSF19 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |