CHST12 monoclonal antibody (M01), clone 3D6 View larger

CHST12 monoclonal antibody (M01), clone 3D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHST12 monoclonal antibody (M01), clone 3D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about CHST12 monoclonal antibody (M01), clone 3D6

Brand: Abnova
Reference: H00055501-M01
Product name: CHST12 monoclonal antibody (M01), clone 3D6
Product description: Mouse monoclonal antibody raised against a partial recombinant CHST12.
Clone: 3D6
Isotype: IgG2a Kappa
Gene id: 55501
Gene name: CHST12
Gene alias: C4S-2|C4ST-2|C4ST2
Gene description: carbohydrate (chondroitin 4) sulfotransferase 12
Genbank accession: NM_018641
Immunogen: CHST12 (NP_061111.1, 56 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RDRELTADSDVDEFLDKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGYDWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFPTKERAFDDIP
Protein accession: NP_061111.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055501-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055501-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged CHST12 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CHST12 monoclonal antibody (M01), clone 3D6 now

Add to cart