Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00055437-M02 |
Product name: | STRADB monoclonal antibody (M02), clone 3E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STRADB. |
Clone: | 3E11 |
Isotype: | IgG2b Kappa |
Gene id: | 55437 |
Gene name: | STRADB |
Gene alias: | ALS2CR2|CALS-21|ILPIP|ILPIPA|MGC102916|PAPK|PRO1038 |
Gene description: | STE20-related kinase adaptor beta |
Genbank accession: | BC008302 |
Immunogen: | STRADB (AAH08302, 319 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF |
Protein accession: | AAH08302 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of STRADB expression in transfected 293T cell line by STRADB monoclonal antibody (M02), clone 3E11. Lane 1: STRADB transfected lysate (Predicted MW: 47 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |