| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr | 
| Brand: | Abnova | 
| Reference: | H00055437-M02 | 
| Product name: | STRADB monoclonal antibody (M02), clone 3E11 | 
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STRADB. | 
| Clone: | 3E11 | 
| Isotype: | IgG2b Kappa | 
| Gene id: | 55437 | 
| Gene name: | STRADB | 
| Gene alias: | ALS2CR2|CALS-21|ILPIP|ILPIPA|MGC102916|PAPK|PRO1038 | 
| Gene description: | STE20-related kinase adaptor beta | 
| Genbank accession: | BC008302 | 
| Immunogen: | STRADB (AAH08302, 319 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | SSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF | 
| Protein accession: | AAH08302 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Western Blot analysis of STRADB expression in transfected 293T cell line by STRADB monoclonal antibody (M02), clone 3E11. Lane 1: STRADB transfected lysate (Predicted MW: 47 KDa). Lane 2: Non-transfected lysate.  | 
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr | 
| Shipping condition: | Dry Ice |