| Brand:  | Abnova | 
| Reference:  | H00055361-M01 | 
| Product name:  | PI4KII monoclonal antibody (M01), clone 3E1 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant PI4KII. | 
| Clone:  | 3E1 | 
| Isotype:  | IgG2b Kappa | 
| Gene id:  | 55361 | 
| Gene name:  | PI4K2A | 
| Gene alias:  | DKFZp761G1923|PI4KII|PIK42A|RP11-548K23.6 | 
| Gene description:  | phosphatidylinositol 4-kinase type 2 alpha | 
| Genbank accession:  | NM_018425 | 
| Immunogen:  | PI4KII (NP_060895.1, 383 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | LILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFS | 
| Protein accession:  | NP_060895.1 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged PI4K2A is 1 ng/ml as a capture antibody. | 
| Applications:  | S-ELISA,ELISA | 
| Shipping condition:  | Dry Ice |