| Brand: | Abnova |
| Reference: | H00055361-M01 |
| Product name: | PI4KII monoclonal antibody (M01), clone 3E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PI4KII. |
| Clone: | 3E1 |
| Isotype: | IgG2b Kappa |
| Gene id: | 55361 |
| Gene name: | PI4K2A |
| Gene alias: | DKFZp761G1923|PI4KII|PIK42A|RP11-548K23.6 |
| Gene description: | phosphatidylinositol 4-kinase type 2 alpha |
| Genbank accession: | NM_018425 |
| Immunogen: | PI4KII (NP_060895.1, 383 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFS |
| Protein accession: | NP_060895.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PI4K2A is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |