Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PI4K2A MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IF,WB-Tr,IP |
More info about PI4K2A MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00055361-D01 |
| Product name: | PI4K2A MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human PI4K2A protein. |
| Gene id: | 55361 |
| Gene name: | PI4K2A |
| Gene alias: | DKFZp761G1923|PI4KII|PIK42A|RP11-548K23.6 |
| Gene description: | phosphatidylinositol 4-kinase type 2 alpha |
| Genbank accession: | NM_018425 |
| Immunogen: | PI4K2A (NP_060895.1, 1 a.a. ~ 479 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW |
| Protein accession: | NP_060895.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of PI4K2A transfected lysate using anti-PI4K2A MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PI4KII purified MaxPab mouse polyclonal antibody (B01P) (H00055361-B01P). |
| Applications: | IF,WB-Tr,IP |
| Shipping condition: | Dry Ice |