CNO monoclonal antibody (M02A), clone 6C3 View larger

CNO monoclonal antibody (M02A), clone 6C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNO monoclonal antibody (M02A), clone 6C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CNO monoclonal antibody (M02A), clone 6C3

Brand: Abnova
Reference: H00055330-M02A
Product name: CNO monoclonal antibody (M02A), clone 6C3
Product description: Mouse monoclonal antibody raised against a partial recombinant CNO.
Clone: 6C3
Isotype: IgG1 Kappa
Gene id: 55330
Gene name: CNO
Gene alias: BCAS4L|FLJ11230
Gene description: cappuccino homolog (mouse)
Genbank accession: NM_018366
Immunogen: CNO (NP_060836, 108 a.a. ~ 217 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GDSSHVVSEGVPRIHAKAAEMRRIYSRIDRLEAFVRMVGGRVARMEEQVTKAEAELGTFPRAFKKLLHTMNVPSLFSKSAPSRPQQAGYEAPVLFRTEDYFPCCSERPQL
Protein accession: NP_060836
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055330-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055330-M02A-1-1-1.jpg
Application image note: CNO monoclonal antibody (M02A), clone 6C3 Western Blot analysis of CNO expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CNO monoclonal antibody (M02A), clone 6C3 now

Add to cart