Brand: | Abnova |
Reference: | H00055330-M02A |
Product name: | CNO monoclonal antibody (M02A), clone 6C3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CNO. |
Clone: | 6C3 |
Isotype: | IgG1 Kappa |
Gene id: | 55330 |
Gene name: | CNO |
Gene alias: | BCAS4L|FLJ11230 |
Gene description: | cappuccino homolog (mouse) |
Genbank accession: | NM_018366 |
Immunogen: | CNO (NP_060836, 108 a.a. ~ 217 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GDSSHVVSEGVPRIHAKAAEMRRIYSRIDRLEAFVRMVGGRVARMEEQVTKAEAELGTFPRAFKKLLHTMNVPSLFSKSAPSRPQQAGYEAPVLFRTEDYFPCCSERPQL |
Protein accession: | NP_060836 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CNO monoclonal antibody (M02A), clone 6C3 Western Blot analysis of CNO expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |