FBXW7 purified MaxPab mouse polyclonal antibody (B01P) View larger

FBXW7 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXW7 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FBXW7 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00055294-B01P
Product name: FBXW7 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human FBXW7 protein.
Gene id: 55294
Gene name: FBXW7
Gene alias: AGO|CDC4|DKFZp686F23254|FBW6|FBW7|FBX30|FBXO30|FBXW6|FLJ16457|SEL-10|SEL10
Gene description: F-box and WD repeat domain containing 7
Genbank accession: NM_018315.3
Immunogen: FBXW7 (NP_060785.2, 1 a.a. ~ 627 a.a) full-length human protein.
Immunogen sequence/protein sequence: MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRTHGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
Protein accession: NP_060785.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055294-B01P-13-15-1.jpg
Application image note: Western Blot analysis of FBXW7 expression in transfected 293T cell line (H00055294-T01) by FBXW7 MaxPab polyclonal antibody.

Lane 1: FBXW7 transfected lysate(68.97 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice
Publications: Cell cycle-dependent ubiquitylation and destruction of NDE1 by CDK5-FBW7 regulates ciliary length.Dipak Maskey, Matthew Caleb Marlin, Seokho Kim, Sehyun Kim, E-Ching Ong, Guangpu Li, Leonidas Tsiokas.
EMBO J 2015 Jul 23. Epub 2015 Jul 23.

Reviews

Buy FBXW7 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart