View larger

BRF2 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of BRF2 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00055290-A01
Product name:	BRF2 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant BRF2.
Gene id:	55290
Gene name:	BRF2
Gene alias:	BRFU\|FLJ11052\|TFIIIB50
Gene description:	BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like
Genbank accession:	NM_018310
Immunogen:	BRF2 (NP_060780, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQA
Protein accession:	NP_060780
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.11 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	BRF2 polyclonal antibody (A01), Lot # 060707JCS1. Western Blot analysis of BRF2 expression in human ovarian cancer.
Applications:	WB-Ti,ELISA,WB-Re
Shipping condition:	Dry Ice