Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RHOT1 monoclonal antibody (M01), clone 4H4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about RHOT1 monoclonal antibody (M01), clone 4H4
| Brand: | Abnova |
| Reference: | H00055288-M01 |
| Product name: | RHOT1 monoclonal antibody (M01), clone 4H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RHOT1. |
| Clone: | 4H4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 55288 |
| Gene name: | RHOT1 |
| Gene alias: | ARHT1|FLJ11040|FLJ12633|MIRO-1 |
| Gene description: | ras homolog gene family, member T1 |
| Genbank accession: | NM_018307 |
| Immunogen: | RHOT1 (NP_060777, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP |
| Protein accession: | NP_060777 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RHOT1 monoclonal antibody (M01), clone 4H4 Western Blot analysis of RHOT1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Brain-Derived Neurotrophic Factor (BDNF)-Induced Mitochondrial Motility Arrest and Presynaptic Docking Contribute to BDNF-Enhanced Synaptic Transmission.Su B, Ji YS, Sun XL, Liu XH, Chen ZY J Biol Chem. 2014 Jan 17;289(3):1213-26. doi: 10.1074/jbc.M113.526129. Epub 2013 Dec 3. |