No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00055284-M01 |
Product name: | UBE2W monoclonal antibody (M01), clone 7G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UBE2W. |
Clone: | 7G4 |
Isotype: | IgG2a Kappa |
Gene id: | 55284 |
Gene name: | UBE2W |
Gene alias: | FLJ11011|hUBC-16 |
Gene description: | ubiquitin-conjugating enzyme E2W (putative) |
Genbank accession: | NM_001001481 |
Immunogen: | UBE2W (NP_001001481, 17 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSP |
Protein accession: | NP_001001481 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to UBE2W on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |