FLJ10986 purified MaxPab mouse polyclonal antibody (B01P) View larger

FLJ10986 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ10986 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FLJ10986 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00055277-B01P
Product name: FLJ10986 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human FLJ10986 protein.
Gene id: 55277
Gene name: FGGY
Gene alias: FLJ10986
Gene description: FGGY carbohydrate kinase domain containing
Genbank accession: NM_018291.2
Immunogen: FLJ10986 (NP_060761.2, 1 a.a. ~ 439 a.a) full-length human protein.
Immunogen sequence/protein sequence: MWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTYSAEKGWDDSFWKMIGLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLLPGIAVAASLIDAHAGGLGVIGADVRGHGLICEGQPVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVEHQKEYLAIMNDD
Protein accession: NP_060761.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055277-B01P-13-15-1.jpg
Application image note: Western Blot analysis of FGGY expression in transfected 293T cell line (H00055277-T01) by FGGY MaxPab polyclonal antibody.

Lane 1: FLJ10986 transfected lysate(48.29 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FLJ10986 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart