| Brand: | Abnova |
| Reference: | H00055276-M05 |
| Product name: | PGM2 monoclonal antibody (M05), clone 1A3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PGM2. |
| Clone: | 1A3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 55276 |
| Gene name: | PGM2 |
| Gene alias: | FLJ10983|MSTP006 |
| Gene description: | phosphoglucomutase 2 |
| Genbank accession: | BC010087.2 |
| Immunogen: | PGM2 (AAH10087.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAPEGSGLGEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLE |
| Protein accession: | AAH10087.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PGM2 monoclonal antibody (M05), clone 1A3 Western Blot analysis of PGM2 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.Katsogiannou M, Andrieu C, Baylot V, Baudot A, Dusetti NJ, Gayet O, Finetti P, Garrido C, Birnbaum D, Bertucci F, Brun C, Rocchi P Mol Cell Proteomics. 2014 Oct 2. pii: mcp.M114.041228. |