Brand: | Abnova |
Reference: | H00055236-M08 |
Product name: | FLJ10808 monoclonal antibody (M08), clone 1D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FLJ10808. |
Clone: | 1D11 |
Isotype: | IgG2b Kappa |
Gene id: | 55236 |
Gene name: | UBA6 |
Gene alias: | FLJ10808|FLJ23367|MOP-4|UBE1L2 |
Gene description: | ubiquitin-like modifier activating enzyme 6 |
Genbank accession: | NM_018227 |
Immunogen: | FLJ10808 (NP_060697, 962 a.a. ~ 1051 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPTTEKKYVDLTVSFAPDIDGDEDLPGPPVRYYFSHDT |
Protein accession: | NP_060697 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to UBA6 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |