| Brand: | Abnova |
| Reference: | H00055213-M07 |
| Product name: | RCBTB1 monoclonal antibody (M07), clone 1E4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RCBTB1. |
| Clone: | 1E4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 55213 |
| Gene name: | RCBTB1 |
| Gene alias: | CLLD7|CLLL7|GLP|MGC33184|RP11-185C18.1 |
| Gene description: | regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1 |
| Genbank accession: | NM_018191 |
| Immunogen: | RCBTB1 (NP_060661.3, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQSTLVPKKLEGLCGKKIKSLSYGSGPHVLLS |
| Protein accession: | NP_060661.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged RCBTB1 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |