Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ARL8B monoclonal antibody (M01), clone 1A2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | ELISA |
More info about ARL8B monoclonal antibody (M01), clone 1A2
| Reference: | H00055207-M01 |
| Product name: | ARL8B monoclonal antibody (M01), clone 1A2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ARL8B. |
| Clone: | 1A2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 55207 |
| Gene name: | ARL8B |
| Gene alias: | ARL10C|FLJ10702|Gie1 |
| Gene description: | ADP-ribosylation factor-like 8B |
| Genbank accession: | BC013131 |
| Immunogen: | ARL8B (AAH13131, 1 a.a. ~ 186 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS |
| Protein accession: | AAH13131 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |