| Brand: | Abnova |
| Reference: | H00055201-M05 |
| Product name: | MAP1S monoclonal antibody (M05), clone 4H2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAP1S. |
| Clone: | 4H2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 55201 |
| Gene name: | MAP1S |
| Gene alias: | BPY2IP1|C19orf5|FLJ10669|MAP8|MGC133087|VCY2IP-1|VCY2IP1 |
| Gene description: | microtubule-associated protein 1S |
| Genbank accession: | NM_018174 |
| Immunogen: | MAP1S (NP_060644.4, 929 a.a. ~ 1026 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAE |
| Protein accession: | NP_060644.4 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MAP1S is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |