| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00055186-B01 |
| Product name: | SLC25A36 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SLC25A36 protein. |
| Gene id: | 55186 |
| Gene name: | SLC25A36 |
| Gene alias: | DKFZp564C053|FLJ10618 |
| Gene description: | solute carrier family 25, member 36 |
| Genbank accession: | BC014064 |
| Immunogen: | SLC25A36 (AAH14064, 1 a.a. ~ 311 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASYAGISETVIHFVIYESIKQKLLEYKTASTMENDEESVKEASDFVGMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSLYRGLTTHLVRQIPNTAIMMATYELVVYLLNG |
| Protein accession: | AAH14064 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SLC25A36 expression in transfected 293T cell line (H00055186-T01) by SLC25A36 MaxPab polyclonal antibody. Lane 1: SLC25A36 transfected lysate(34.32 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |