| Brand: | Abnova |
| Reference: | H00055182-M01 |
| Product name: | FLJ10597 monoclonal antibody (M01), clone 5E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FLJ10597. |
| Clone: | 5E5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 55182 |
| Gene name: | RNF220 |
| Gene alias: | C1orf164|FLJ10597 |
| Gene description: | ring finger protein 220 |
| Genbank accession: | NM_018150 |
| Immunogen: | FLJ10597 (NP_060620, 468 a.a. ~ 566 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QEAMQKTCKNSDIEKITEDSAVTTFEALKARVRELERQLSRGDRYKCLICMDSYSMPLTSIQCWHVHCEECWLRTLGAKKLCPQCNTITAPGDLRRIYL |
| Protein accession: | NP_060620 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged C1orf164 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |