Brand: | Abnova |
Reference: | H00055167-M01 |
Product name: | RNF184 monoclonal antibody (M01), clone 3A4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF184. |
Clone: | 3A4 |
Isotype: | IgG1 Kappa |
Gene id: | 55167 |
Gene name: | MSL2 |
Gene alias: | FLJ10546|KIAA1585|MSL-2|MSL2L1|RNF184 |
Gene description: | male-specific lethal 2 homolog (Drosophila) |
Genbank accession: | NM_018133 |
Immunogen: | RNF184 (NP_060603, 478 a.a. ~ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GQRCPCYSNRKACLDCICRGCQNSYMANGEKKLEAFAVPEKALEQTRLTLGINVTSIAVRNASTSTSVINVTGSPVTTFLAASTHDDKSLDEAIDMRF |
Protein accession: | NP_060603 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MSL2 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |