RNF184 monoclonal antibody (M01), clone 3A4 View larger

RNF184 monoclonal antibody (M01), clone 3A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF184 monoclonal antibody (M01), clone 3A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about RNF184 monoclonal antibody (M01), clone 3A4

Brand: Abnova
Reference: H00055167-M01
Product name: RNF184 monoclonal antibody (M01), clone 3A4
Product description: Mouse monoclonal antibody raised against a partial recombinant RNF184.
Clone: 3A4
Isotype: IgG1 Kappa
Gene id: 55167
Gene name: MSL2
Gene alias: FLJ10546|KIAA1585|MSL-2|MSL2L1|RNF184
Gene description: male-specific lethal 2 homolog (Drosophila)
Genbank accession: NM_018133
Immunogen: RNF184 (NP_060603, 478 a.a. ~ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GQRCPCYSNRKACLDCICRGCQNSYMANGEKKLEAFAVPEKALEQTRLTLGINVTSIAVRNASTSTSVINVTGSPVTTFLAASTHDDKSLDEAIDMRF
Protein accession: NP_060603
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055167-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged MSL2 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy RNF184 monoclonal antibody (M01), clone 3A4 now

Add to cart