| Brand: | Abnova |
| Reference: | H00055163-A01 |
| Product name: | PNPO polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PNPO. |
| Gene id: | 55163 |
| Gene name: | PNPO |
| Gene alias: | FLJ10535|PDXPO |
| Gene description: | pyridoxamine 5'-phosphate oxidase |
| Genbank accession: | NM_018129 |
| Immunogen: | PNPO (NP_060599, 163 a.a. ~ 261 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP |
| Protein accession: | NP_060599 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PNPO polyclonal antibody (A01), Lot # 060529JCS1 Western Blot analysis of PNPO expression in MES-SA/Dx5 ( Cat # L021V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Toxicological biomarkers of 2,3,4,7,8-pentachlorodibenzofuran in proteins secreted by HepG2 cells.Phark S, Park SY, Choi S, Zheng Z, Cho E, Lee M, Lim JY, Seo JB, Won NH, Jung WW, Sul D. Biochim Biophys Acta. 2012 Jan 30. [Epub ahead of print] |