Cart 8 Product Products 2 541,78 € (empty)
No products
To be determined Shipping
2 541,78 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 8 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 541,78 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 541,78 €
Data sheet of RFWD3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about RFWD3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00055159-A01 |
| Product name: | RFWD3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant RFWD3. |
| Gene id: | 55159 |
| Gene name: | RFWD3 |
| Gene alias: | FLJ10520|RNF201 |
| Gene description: | ring finger and WD repeat domain 3 |
| Genbank accession: | BC059371 |
| Immunogen: | RFWD3 (AAH59371, 651 a.a. ~ 749 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | DTGNPICSCQPVHTFFGGPTCKLLTKNAIFQSPENDGNILVCTGDEAANSALLWDAASGSLLQDLQTDQPVLDICPFEVNRNSYLATLTEKMVHTYKWE |
| Protein accession: | AAH59371 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |